PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR12G14640.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family B3
Protein Properties Length: 1115aa    MW: 127835 Da    PI: 7.0932
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR12G14640.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B3469.7e-1568150190
                      EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE CS
               B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsef 90 
                      ffk+l       s+ +++p k ae+++g+ ++     l+ +sg++W++ +  +k  ++ +l++GW++F++a++L+e+D ++F+ +g+s++
  LPERR12G14640.1  68 FFKIL---TEDCSHGISIPEKIAERFSGEITK--GFNLKAPSGETWRIGI--EKVADELFLKSGWEDFAEAHELQEKDLLIFTCKGNSNG 150
                      66666...33445669**********777555..59999***********..*******************************9998776 PP

2B336.21.1e-11296393199
                      EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SS.SEE..E CS
               B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgr.sefelv 93 
                      f++vl++++  ++++l++p  fa++h  + +++  + +++ + ++W vk+ y ++  r +    W +F ++n++++g +++F+l++  ++ +++
  LPERR12G14640.1 296 FVTVLKTANIRRKSLLIVPTGFADDHLDS-RSHEIVLIRQNKKEKWYVKY-YHGSTTRGFNCHRWIKFLRENRMQDGYICIFELMKGaKRVTMT 387
                      8899999999****************433.3444566666888*******.6555555445568*******************99877999999 PP

                      EEEE-S CS
               B3  94 vkvfrk 99 
                      v+v+ k
  LPERR12G14640.1 388 VHVIGK 393
                      999865 PP

3B346.28e-15422504190
                      EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE CS
               B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsef 90 
                      ffk+l       s+++++p k ae+ +g+ ++     l+ +sg++W v +  +k  ++ +l +GW++F+ka++L+e+D + F+ +g+s++
  LPERR12G14640.1 422 FFKIL---TEDCSHCISIPEKVAERLSGEITK--GFNLKAPSGKTWCVGI--EKVADELLLMSGWEDFAKAHELQENDLLFFSCKGNSNG 504
                      66766...3334556***********777555..59999***********..*******************************9988776 PP

4B342.89.1e-14654751199
                      EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEE.TTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SS.SEE.. CS
               B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltled.esgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgr.sefel 92 
                      f++vl++++  ++++lv+p  fa+eh  +  +s +++l    + ++W vk+ + ++ ++++    W +F ++n+L++g +++F+l++  ++ ++
  LPERR12G14640.1 654 FVTVLKTANIRRKSLLVVPSGFADEHLDS--RSHEIVLIIpNKKEKWYVKYYHGNNTRGFICH-RWFKFIRENRLQDGYICIFELMKGaKRVTM 744
                      8899999999****************434..34456665527779******666666666555.9*******************9987799999 PP

                      EEEEE-S CS
               B3  93 vvkvfrk 99 
                      +v+v+ k
  LPERR12G14640.1 745 TVHVIGK 751
                      9999865 PP

5B346.56.7e-158058861499
                      T-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS
               B3  14 grlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99 
                      +r+++p kfa++++g+  ++    l+  sg +W v +  +k  ++++l +GW++F+ka++Lke+D + F+ +g+ + ++ v +f++
  LPERR12G14640.1 805 HRVSIPEKFAKNFNGQIIKG--FNLKAFSGGTWHVDV--EKVADEMFLVSGWEDFAKAHELKENDLLFFTCNGKGSCSFDVLIFDA 886
                      789*******9887775554..9999***********..*******************************8877555578888876 PP

6B347.23.9e-1510091106199
                       EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEE.TTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SS.SEE CS
               B3    1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltled.esgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgr.sef 90  
                       f++vl + +v+++++l++p  fa++h     +s +++l    + ++W  k+ + ++ +++  + GW +F   n+L+eg +++F+l++  ++ 
  LPERR12G14640.1 1009 FVTVLRTGHVHRKNILIVPAGFAANHLDR--KSHEIMLVRpNRKEKWYAKYYHANNTRGF-SGYGWIKFICKNKLQEGYVCIFELMKGaKRP 1097
                       8899999****************999444..45578887736669******767777675.677********************99877999 PP

                       ..EEEEE-S CS
               B3   91 elvvkvfrk 99  
                       +++v+v++k
  LPERR12G14640.1 1098 TMTVHVISK 1106
                       999999986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019365.49E-1761164IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086311.70265162IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.106.7E-1867164IPR015300DNA-binding pseudobarrel domain
CDDcd100171.44E-1267160No hitNo description
PfamPF023621.2E-1168150IPR003340B3 DNA binding domain
SMARTSM010191.3E-768162IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.104.1E-15289392IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019364.32E-16290390IPR015300DNA-binding pseudobarrel domain
CDDcd100174.17E-12294391No hitNo description
PfamPF023621.7E-10296392IPR003340B3 DNA binding domain
PROSITE profilePS5086311.815296394IPR003340B3 DNA binding domain
SMARTSM010198.9E-7296394IPR003340B3 DNA binding domain
SuperFamilySSF1019362.94E-17417518IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086311.66419516IPR003340B3 DNA binding domain
CDDcd100172.32E-13421514No hitNo description
PfamPF023625.9E-12422504IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.6E-17422518IPR015300DNA-binding pseudobarrel domain
SMARTSM010191.2E-8422516IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.103.4E-17647750IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.73E-17648750IPR015300DNA-binding pseudobarrel domain
CDDcd100172.56E-14652749No hitNo description
PROSITE profilePS5086312.351654752IPR003340B3 DNA binding domain
PfamPF023625.0E-12654750IPR003340B3 DNA binding domain
SMARTSM010197.8E-9654752IPR003340B3 DNA binding domain
SuperFamilySSF1019362.94E-18789889IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086312.421792887IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.102.6E-18794889IPR015300DNA-binding pseudobarrel domain
CDDcd100174.95E-15794885No hitNo description
SMARTSM010194.0E-6795887IPR003340B3 DNA binding domain
PfamPF023621.0E-11805886IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.4E-1810011104IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.24E-1810021104IPR015300DNA-binding pseudobarrel domain
CDDcd100171.23E-1410071102No hitNo description
PfamPF023621.8E-1310091106IPR003340B3 DNA binding domain
PROSITE profilePS5086312.2110091107IPR003340B3 DNA binding domain
SMARTSM010192.5E-1310091107IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1115 aa     Download sequence    Send to blast
MLSAKGKSSH SLFDPLTVLT ANFTRDQDYG NSILKKHAKV MAEKGCESCS RWQEHFYREH  60
MDVSRIRFFK ILTEDCSHGI SIPEKIAERF SGEITKGFNL KAPSGETWRI GIEKVADELF  120
LKSGWEDFAE AHELQEKDLL IFTCKGNSNG ICSFDVLIFD ASGCEKVSCF FTGKTDSYMF  180
KNFNNTDGQD AEQYLLSDSE DTNTPPYLVV SPHKGSTSIK LSGKTKNSPR KEPEDPNSSR  240
CHVKHDMIEE EDNDYDEHTD DEHDDYSYSR FASYLNVKER KQIFSLVSLQ PGNPVFVTVL  300
KTANIRRKSL LIVPTGFADD HLDSRSHEIV LIRQNKKEKW YVKYYHGSTT RGFNCHRWIK  360
FLRENRMQDG YICIFELMKG AKRVTMTVHV IGKVMAEKVC ASCSKWQEHC YREHMDVCRI  420
RFFKILTEDC SHCISIPEKV AERLSGEITK GFNLKAPSGK TWCVGIEKVA DELLLMSGWE  480
DFAKAHELQE NDLLFFSCKG NSNGICSFDV LIFDASGCEK LSCFFISKKY SYICKHFNNT  540
DSQNAEQYLS SDCEDTNTPP YLLGSPHKDS TSKKLSGKTK TNPSTSTGKE PEDPNSSRCH  600
VKHEMIEEEE SDDDEHTDDE HDDYSYSRFA SYLNSKERKQ IFSLVSLQPG NPVFVTVLKT  660
ANIRRKSLLV VPSGFADEHL DSRSHEIVLI IPNKKEKWYV KYYHGNNTRG FICHRWFKFI  720
RENRLQDGYI CIFELMKGAK RVTMTVHVIG KVDNRNVCGA LYDAGEVMAD KGCESCSKWQ  780
EHYYREHTDG SRICFFRLMT GDFAHRVSIP EKFAKNFNGQ IIKGFNLKAF SGGTWHVDVE  840
KVADEMFLVS GWEDFAKAHE LKENDLLFFT CNGKGSCSFD VLIFDASGCE KMPDFFTSKK  900
YNYMCKHFNN ISGQNVEHCL LSDSDDTSTP SYMAGSHKAA TSKKVNGKTK ISPSKEPENV  960
KQEMIEEEES DGDDEHVDYY YSRFANYLTS EEREEIFSLT SLQPGNPVFV TVLRTGHVHR  1020
KNILIVPAGF AANHLDRKSH EIMLVRPNRK EKWYAKYYHA NNTRGFSGYG WIKFICKNKL  1080
QEGYVCIFEL MKGAKRPTMT VHVISKINNR FVLLG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015619600.10.0PREDICTED: B3 domain-containing protein Os12g0592300
SwissprotQ2QMT20.0Y1223_ORYSJ; B3 domain-containing protein Os12g0592300
TrEMBLA0A0D9Y1110.0A0A0D9Y111_9ORYZ; Uncharacterized protein
STRINGORGLA12G0150600.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP56234179
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G33280.16e-25B3 family protein